Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRL Rabbit pAb (APR25323N)
APR25323N-01 50 µL

CTRL Rabbit pAb (APR25323N)

Sign In for Pricing
View Details
CTRL Rabbit pAb (APR25323N)
APR25323N-02 100 µL

CTRL Rabbit pAb (APR25323N)

Sign In for Pricing
View Details
CTRL Rabbit pAb (APR25323N)
APR25323N-03 200 µL

CTRL Rabbit pAb (APR25323N)

Sign In for Pricing
View Details
Olfr347 Mouse siRNA Oligo Duplex (Locus ID 258945)
SR409677 1 Kit

Olfr347 Mouse siRNA Oligo Duplex (Locus ID 258945)

Sign In for Pricing
View Details
BPHL (NM_004332) Human Tagged Lenti ORF Clone
RC229142L4 10 µg

BPHL (NM_004332) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse PKCe Matched Antibody Pair Set [ABP-S-052294]
ABP-S-052294 5 Plates

Mouse PKCe Matched Antibody Pair Set [ABP-S-052294]

Sign In for Pricing
View Details