Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrillin 3 (FBN3) Rabbit ELISA Kit
D3776 96 Tests

Fibrillin 3 (FBN3) Rabbit ELISA Kit

Sign In for Pricing
View Details
MLLT10 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila) ; Translocated to, 10, AF10, DKFZp686E10210, MGC75086) (MaxLight 550)
248797-ML550 100 µL

MLLT10 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila) ; Translocated to, 10, AF10, DKFZp686E10210, MGC75086) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Monoclonal CD74 Antibody (OTI1H3) [CoraFluor 1]
NBP2-70382CL1 0.1 mL

Mouse Monoclonal CD74 Antibody (OTI1H3) [CoraFluor 1]

Sign In for Pricing
View Details
D15Ertd621e CRISPR Activation Plasmid (m)
sc-431717-ACT 20 µg

D15Ertd621e CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal Integrin alpha 2b/CD41 Antibody (M148) [Alexa Fluor 488]
NB100-2614AF488 0.1 mL

Mouse Monoclonal Integrin alpha 2b/CD41 Antibody (M148) [Alexa Fluor 488]

Sign In for Pricing
View Details
PTPN7 AAV Vector (Rat) (CMV)
38166106 1 µg

PTPN7 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details