Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

50% Potassium Lactate (10 ml per vial)
FD123-5VL 5 VL

50% Potassium Lactate (10 ml per vial)

Sign In for Pricing
View Details
Mouse Cluster of Differentiation 99 (CD99) ELISA Kit-Sandwich
EK5F918-01 48 Test

Mouse Cluster of Differentiation 99 (CD99) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Cluster of Differentiation 99 (CD99) ELISA Kit-Sandwich
EK5F918-02 96 Tests

Mouse Cluster of Differentiation 99 (CD99) ELISA Kit-Sandwich

Sign In for Pricing
View Details
U6 snRNA-associated Sm-Like protein LSm3 (LSM3) Bovine ELISA Kit
H9924 96 Tests

U6 snRNA-associated Sm-Like protein LSm3 (LSM3) Bovine ELISA Kit

Sign In for Pricing
View Details
Ngef Mouse shRNA Lentiviral Particle (Locus ID 53972)
TL516613V 500 µL Each

Ngef Mouse shRNA Lentiviral Particle (Locus ID 53972)

Sign In for Pricing
View Details
Recombinant Mouse HSPB11 Protein, His (Fc)-Avi-tagged
HSPB11-4361M 50 µg

Recombinant Mouse HSPB11 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details