Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC498685 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6548403 1.0 µg DNA

LOC498685 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SURF1 (Surfeit 1) discontinued
219260-01 20 µL

SURF1 (Surfeit 1) discontinued

Sign In for Pricing
View Details
SURF1 (Surfeit 1) discontinued
219260-02 100 µL

SURF1 (Surfeit 1) discontinued

Sign In for Pricing
View Details
SETD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2128308 1.0 µg DNA

SETD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human GATAT2 (Endothelial transcription factor GATA-2) ELISA Kit
MBS7606061-01 48 Well

Human GATAT2 (Endothelial transcription factor GATA-2) ELISA Kit

Sign In for Pricing
View Details
Human GATAT2 (Endothelial transcription factor GATA-2) ELISA Kit
MBS7606061-02 96 Well

Human GATAT2 (Endothelial transcription factor GATA-2) ELISA Kit

Sign In for Pricing
View Details