Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR120 (FFAR4) Rabbit Polyclonal Antibody
TA368399 100 µL

GPR120 (FFAR4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fbxo3 Mouse qPCR Template Standard (NM_212433)
MK203809 1 Kit

Fbxo3 Mouse qPCR Template Standard (NM_212433)

Sign In for Pricing
View Details
Hnrnpdl (NM_001033696) Rat Tagged Lenti ORF Clone
RR201386L3 10 µg

Hnrnpdl (NM_001033696) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
3- (4-Amino-3,5-dibromophenoxy) -2,4,6-tribromobenzenamine
422744-01 50 mg

3- (4-Amino-3,5-dibromophenoxy) -2,4,6-tribromobenzenamine

Sign In for Pricing
View Details
3- (4-Amino-3,5-dibromophenoxy) -2,4,6-tribromobenzenamine
422744-02 500 mg

3- (4-Amino-3,5-dibromophenoxy) -2,4,6-tribromobenzenamine

Sign In for Pricing
View Details
Tris-HCl NaCl Buffer 1X
42020108-1 500 mL

Tris-HCl NaCl Buffer 1X

Sign In for Pricing
View Details