Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

n-Myc (MYCN) (C-term) Rabbit Polyclonal Antibody
AP17575PU-N 400 µL

n-Myc (MYCN) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATG4B (NM_013325) Human Tagged ORF Clone Lentiviral Particle
RC200289L2V 200 µL

ATG4B (NM_013325) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse apelin 12, AP12 ELISA Kit
NB-E20310 96 Well

Mouse apelin 12, AP12 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CYP24A1 Antibody
NBP2-57213-25ul 25 µL

Rabbit Polyclonal CYP24A1 Antibody

Sign In for Pricing
View Details
C-Metphosphorylated Y1349 (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-Oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-Protein Kinase Met, MET) discontinued
221178-01 50 µL

C-Metphosphorylated Y1349 (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-Oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-Protein Kinase Met, MET) discontinued

Sign In for Pricing
View Details
C-Metphosphorylated Y1349 (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-Oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-Protein Kinase Met, MET) discontinued
221178-02 100 µL

C-Metphosphorylated Y1349 (Hepatocyte Growth Factor Receptor, HGF Receptor, HGF/SF Receptor, Proto-Oncogene c-Met, Scatter Factor Receptor, SF Receptor, Tyrosine-Protein Kinase Met, MET) discontinued

Sign In for Pricing
View Details