Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDS ultrapure for molecular biology
1177KG001 1 Kg

SDS ultrapure for molecular biology

Sign In for Pricing
View Details
FAM73A Protein Vector (Mouse) (pPM-C-HA)
PV178116 500 ng

FAM73A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
UBA7 AAV Vector (Human) (CMV)
48926101 1 µg

UBA7 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Xpress™ Human SLC2A2 Over-expressing Stable Cell Line
ABC-X2852 1 Vial

Xpress™ Human SLC2A2 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
PITX1 (Pituitary Homeobox 1, Paired-like Homeodomain Transcription Factor 1, Homeobox Protein PITX1, Hindlimb-expressed Homeobox Protein Backfoot, PTX1, BFT) (HRP)
MBS6154186-01 0.1 mL

PITX1 (Pituitary Homeobox 1, Paired-like Homeodomain Transcription Factor 1, Homeobox Protein PITX1, Hindlimb-expressed Homeobox Protein Backfoot, PTX1, BFT) (HRP)

Sign In for Pricing
View Details
PITX1 (Pituitary Homeobox 1, Paired-like Homeodomain Transcription Factor 1, Homeobox Protein PITX1, Hindlimb-expressed Homeobox Protein Backfoot, PTX1, BFT) (HRP)
MBS6154186-02 5x 0.1 mL

PITX1 (Pituitary Homeobox 1, Paired-like Homeodomain Transcription Factor 1, Homeobox Protein PITX1, Hindlimb-expressed Homeobox Protein Backfoot, PTX1, BFT) (HRP)

Sign In for Pricing
View Details