Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pde6d sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3361004 1.0 µg DNA

Pde6d sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
T3 (Triiodothyronine) BioAssayTM ELISA Kit (Rat) discontinued
519515 96 Tests

T3 (Triiodothyronine) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Sulphate Reducing HiVeg® Medium (Triple Pack)
MV803-100G 100 g

Sulphate Reducing HiVeg® Medium (Triple Pack)

Sign In for Pricing
View Details
GABA transaminase (ABAT) Rabbit mAb
E45R12055N-100 100 µL

GABA transaminase (ABAT) Rabbit mAb

Sign In for Pricing
View Details
SH2D1A Protein Vector (Human) (pPB-N-His)
PV037886 500 ng

SH2D1A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
C4BPB (NM_001017365) Human Over-expression Lysate
LC422639 20 µg

C4BPB (NM_001017365) Human Over-expression Lysate

Sign In for Pricing
View Details