Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL32P2 ORF Vector (Human) (pORF)
41423011 1.0 µg DNA

RPL32P2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Integrin Beta 1 (ITGB1) Antibody
abx137629-01 5 µg

Integrin Beta 1 (ITGB1) Antibody

Sign In for Pricing
View Details
Integrin Beta 1 (ITGB1) Antibody
abx137629-02 20 µg

Integrin Beta 1 (ITGB1) Antibody

Sign In for Pricing
View Details
Integrin Beta 1 (ITGB1) Antibody
abx137629-03 100 µg

Integrin Beta 1 (ITGB1) Antibody

Sign In for Pricing
View Details
Rat SDC1 (Syndecan 1) ELISA Kit
MBS8804807-01 48 Well

Rat SDC1 (Syndecan 1) ELISA Kit

Sign In for Pricing
View Details
Rat SDC1 (Syndecan 1) ELISA Kit
MBS8804807-02 96 Well

Rat SDC1 (Syndecan 1) ELISA Kit

Sign In for Pricing
View Details