Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-EGFP-Egr2-Neo Plasmid
PVT59387 2 µg

pCMV-EGFP-Egr2-Neo Plasmid

Sign In for Pricing
View Details
PAMM (FAM213A) (NM_032333) Human Tagged ORF Clone Lentiviral Particle
RC201327L1V 200 µL

PAMM (FAM213A) (NM_032333) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal CMYA5 Antibody [CoraFluor 1]
NBP1-77117CL1 0.1 mL

Rabbit Polyclonal CMYA5 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
CLDND2 Rabbit pAb
E47R8014 100 µL

CLDND2 Rabbit pAb

Sign In for Pricing
View Details
Mouse Tgif2lx2 qPCR Primer Pair
QM78298S 200 Tests

Mouse Tgif2lx2 qPCR Primer Pair

Sign In for Pricing
View Details
CCT3 (Chaperonin Containing TCP1 Subunit 3, CCTG, PIG48, TRIC5, CCT-gamma, TCP-1-gamma) discontinued
218858-01 20 µL

CCT3 (Chaperonin Containing TCP1 Subunit 3, CCTG, PIG48, TRIC5, CCT-gamma, TCP-1-gamma) discontinued

Sign In for Pricing
View Details