Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein sidekick-1 (SDK1) ELISA Kit
abx545195 96 Tests

Human Protein sidekick-1 (SDK1) ELISA Kit

Sign In for Pricing
View Details
Closure, Screw-Thread, PP, PTFE/Silicone, 15-415, 288 Pcs.
1219635 288 PCS/PCK

Closure, Screw-Thread, PP, PTFE/Silicone, 15-415, 288 Pcs.

Sign In for Pricing
View Details
Lenti-EF1α-Cre-P2A-EGFP-Puro (10^8TU/ml)
C4102-1ml 1 mL

Lenti-EF1α-Cre-P2A-EGFP-Puro (10^8TU/ml)

Sign In for Pricing
View Details
ZNF576 Protein Vector (Human) (pPM-C-His)
PV048044 500 ng

ZNF576 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human Thymosin beta-4-like protein 3 (TMSL3) ELISA Kit
YP-W11533-01 48 Tests

Human Thymosin beta-4-like protein 3 (TMSL3) ELISA Kit

Sign In for Pricing
View Details
Human Thymosin beta-4-like protein 3 (TMSL3) ELISA Kit
YP-W11533-02 96 Tests

Human Thymosin beta-4-like protein 3 (TMSL3) ELISA Kit

Sign In for Pricing
View Details