Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15/UCRP, Human (His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ISG15/UCRP Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/isg15-ucrp-protein-human-c-6-his.html

Purity

98.00

Smiles

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Formula

9636 (Gene_ID) AAH09507.1 (G2-G157) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Disco-Interacting Protein 2 Homolog C (DIP2C) ELISA Kit
MBS9942187 Inquire

Chicken Disco-Interacting Protein 2 Homolog C (DIP2C) ELISA Kit

Sign In for Pricing
View Details
Anti-C1S Polyclonal Antibody
PHC43601 100 μg

Anti-C1S Polyclonal Antibody

Sign In for Pricing
View Details
Kazrin Polyclonal Antibody, PerCP Conjugated
bs-9707R-PerCP 100 µL

Kazrin Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
RPS18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2037507 1.0 µg DNA

RPS18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Dehydrogenase/reductase SDR family member 7 (FITC)
313324-01 50 µg

Dehydrogenase/reductase SDR family member 7 (FITC)

Sign In for Pricing
View Details
Dehydrogenase/reductase SDR family member 7 (FITC)
313324-02 100 µg

Dehydrogenase/reductase SDR family member 7 (FITC)

Sign In for Pricing
View Details