Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase E (CPE), partial

Product Specifications

Product Name Alternative

(CPE) (Carboxypeptidase H) (CPH) (Enkephalin convertase) (Prohormone-processing carboxypeptidase)

Abbreviation

Recombinant Human CPE protein, partial

Gene Name

CPE

UniProt

P16870

Expression Region

252-363aa

Organism

Homo sapiens (Human)

Target Sequence

LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Sorting receptor that directs prohormones to the regulated secretory pathway. Acts also as a prohormone processing enzyme in neuro/endocrine cells, removing dibasic residues from the C-terminal end of peptide hormone precursors after initial endoprotease cleavage.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.7 kDa

References & Citations

"The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E. Science 314:268-274 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-XPNPEP2 Antibody (4D812)
TMAY-02139-01 20 µL

Anti-XPNPEP2 Antibody (4D812)

Sign In for Pricing
View Details
Anti-XPNPEP2 Antibody (4D812)
TMAY-02139-02 100 µL

Anti-XPNPEP2 Antibody (4D812)

Sign In for Pricing
View Details
Lentiviral mouse Acot3 shRNA (UAS) - Lentiviral mouse Acot3 shRNA (UAS, iRFP) (100)
GTR15261687 1 Vial

Lentiviral mouse Acot3 shRNA (UAS) - Lentiviral mouse Acot3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CFD CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15969124 3x 1.0µg DNA

CFD CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
mPEG-FA, 10K
MF001057-10K Inquire

mPEG-FA, 10K

Sign In for Pricing
View Details
Rabbit Polyclonal mGluR1 Antibody [DyLight 680]
NB110-39033FR 0.1 mL

Rabbit Polyclonal mGluR1 Antibody [DyLight 680]

Sign In for Pricing
View Details