Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase E (CPE), partial

Product Specifications

Product Name Alternative

(CPE) (Carboxypeptidase H) (CPH) (Enkephalin convertase) (Prohormone-processing carboxypeptidase)

Abbreviation

Recombinant Human CPE protein, partial

Gene Name

CPE

UniProt

P16870

Expression Region

252-363aa

Organism

Homo sapiens (Human)

Target Sequence

LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Sorting receptor that directs prohormones to the regulated secretory pathway. Acts also as a prohormone processing enzyme in neuro/endocrine cells, removing dibasic residues from the C-terminal end of peptide hormone precursors after initial endoprotease cleavage.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.7 kDa

References & Citations

"The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E. Science 314:268-274 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBA3 3'UTR Luciferase Stable Cell Line
TU000928 1.0 mL

APBA3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AMACR (NM_203382) Human Tagged Lenti ORF Clone
RC201163L4 10 µg

AMACR (NM_203382) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NBEAL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1394006 1.0 µg DNA

NBEAL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PDGF-B Antibody HRP Conjugated
MBS9459801-01 0.1 mL

PDGF-B Antibody HRP Conjugated

Sign In for Pricing
View Details
PDGF-B Antibody HRP Conjugated
MBS9459801-02 5x 0.1 mL

PDGF-B Antibody HRP Conjugated

Sign In for Pricing
View Details
H2-L Mouse Monoclonal Antibody (PE)
orb2970386-01 50 Tests

H2-L Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details