Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Mouse (HEK293, His)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Mouse (HEK293, His) is the recombinant mouse-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY

Molecular Formula

74499 (Gene_ID) AAK13455.1 (Q24-Y211) (Accession)

Molecular Weight

Approximately 32.0-35.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Enpp4 Mouse siRNA Oligo Duplex (Locus ID 224794)
SR426862 1 Kit

Enpp4 Mouse siRNA Oligo Duplex (Locus ID 224794)

Ask
View Details
HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)
MBS2110056-01 0.1 mL

HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)

Ask
View Details
HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)
MBS2110056-02 0.2 mL

HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)

Ask
View Details
HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)
MBS2110056-03 0.5 mL

HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)

Ask
View Details
HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)
MBS2110056-04 1 mL

HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)

Ask
View Details
HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)
MBS2110056-05 5 mL

HRP-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 11 (LRP11)

Ask
View Details