SOST, Mouse (HEK293, His)
SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Mouse (HEK293, His) is the recombinant mouse-derived SOST protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
SOST Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sost-protein-mouse-hek-293-his.html
Purity
98.0
Smiles
QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
Molecular Formula
74499 (Gene_ID) AAK13455.1 (Q24-Y211) (Accession)
Molecular Weight
Approximately 32.0-35.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880040-100 1x 100 µL
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details