Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1) -VLPs

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

Abbreviation

Recombinant Human STEAP1 protein-VLPs

Gene Name

STEAP1

UniProt

Q9UHE8

Expression Region

1-339aa

Organism

Homo sapiens (Human)

Target Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Tag

C-terminal 10xHis-tagged

Type

MP-VLP Transmembrane Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Metalloreductase that has the ability to reduce both Fe (3+) to Fe (2+) and Cu (2+) to Cu (1+) . Uses NAD (+) as acceptor.

Endotoxin

Not test

Purity

The purity information is not available for VLPs proteins.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VIL1 Antibody
orb2311869-01 20 µg

VIL1 Antibody

Sign In for Pricing
View Details
VIL1 Antibody
orb2311869-02 100 µg

VIL1 Antibody

Sign In for Pricing
View Details
VIL1 Antibody
orb2311869-03 100 ug (without BSA and Azide)

VIL1 Antibody

Sign In for Pricing
View Details
Human E-Cadherin, E-Cad ELISA Kit
CK-bio-11305-01 48 Tests

Human E-Cadherin, E-Cad ELISA Kit

Sign In for Pricing
View Details
Human E-Cadherin, E-Cad ELISA Kit
CK-bio-11305-02 96 Tests

Human E-Cadherin, E-Cad ELISA Kit

Sign In for Pricing
View Details
Human E-Cadherin, E-Cad ELISA Kit
CK-bio-11305-03 5x 96 Tests

Human E-Cadherin, E-Cad ELISA Kit

Sign In for Pricing
View Details