Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ecotin, E. coli (His)

Ecotin, a bacterial protein inhibitor, regulates serine proteases like trypsin and subtilisin. Ecotin's unique surface loop forms a stable complex, influencing enzymatic activity. Ecotin Protein, E. coli (His) is the recombinant E. coli-derived Ecotin protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ecotin Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecotin-protein-e-coli-his.html

Purity

95.00

Smiles

AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

Molecular Formula

946700 (Gene_ID) NP_416713 (A21-R162) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1 beta (ARNT) (NM_178426) Human Recombinant Protein
TP317284L 1 mg

HIF1 beta (ARNT) (NM_178426) Human Recombinant Protein

Sign In for Pricing
View Details
KREMEN1 (NM_001039571) Human Over-expression Lysate
LY422074 100 µg

KREMEN1 (NM_001039571) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexen-5-ol
TRC-H295025-50MG 50 mg

Hexen-5-ol

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562228 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
IL9 (NM_000590) Human Over-expression Lysate
LC424623 20 µg

IL9 (NM_000590) Human Over-expression Lysate

Sign In for Pricing
View Details
PHD2 Rabbit Polyclonal Antibody
R1510-40 100 µL

PHD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details