Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ecotin, E. coli (His)

Ecotin, a bacterial protein inhibitor, regulates serine proteases like trypsin and subtilisin. Ecotin's unique surface loop forms a stable complex, influencing enzymatic activity. Ecotin Protein, E. coli (His) is the recombinant E. coli-derived Ecotin protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ecotin Protein, E. coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecotin-protein-e-coli-his.html

Purity

95.00

Smiles

AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

Molecular Formula

946700 (Gene_ID) NP_416713 (A21-R162) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2,5-dibromo-1,3-oxazole-4-carboxylate
TRC-E915705-25MG 25 mg

Ethyl 2,5-dibromo-1,3-oxazole-4-carboxylate

Sign In for Pricing
View Details
MYLIP Antibody
8C15558-AAT 50 µg

MYLIP Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain,  40nm
GM-101-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free+Bound Kappa Light Chain, 40nm

Sign In for Pricing
View Details
MAP2 Human Gene Knockout Kit (CRISPR)
KN416775 1 Kit

MAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Human OLFM4 (Olfactomedin 4) ELISA Kit
E-UNEL-H0347-01 5x 96 Tests

Uncoated Human OLFM4 (Olfactomedin 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human OLFM4 (Olfactomedin 4) ELISA Kit
E-UNEL-H0347-02 15x 96 Tests

Uncoated Human OLFM4 (Olfactomedin 4) ELISA Kit

Sign In for Pricing
View Details