Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Norrin (Ndp)

Product Specifications

Product Name Alternative

Norrin (Norrie disease protein) (X-linked exudative vitreoretinopathy 2 protein)

Abbreviation

Recombinant Human Ndp protein

Gene Name

Ndp

UniProt

Q00604

Expression Region

25-133aa

Organism

Homo sapiens (Human)

Target Sequence

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. Plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. Acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1) . May be involved in a pathway that regulates neural cell differentiation and proliferation. Possible role in neuroectodermal cell-cell interaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.6 kDa

References & Citations

"Genotype-phenotype variations in five Spanish families with Norrie disease or X-linked FEVR." Riveiro-Alvarez R., Trujillo-Tiebas M.J., Gimenez-Pardo A., Garcia-Hoyos M., Cantalapiedra D., Lorda-Sanchez I., Rodriguez de Alba M., Ramos C., Ayuso C. Mol. Vis. 11:705-712 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-01 0.02 mg (E-Coli)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details
Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-02 0.02 mg (Yeast)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details
Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-03 0.1 mg (E-Coli)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details
Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-04 0.1 mg (Yeast)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details
Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-05 0.02 mg (Baculovirus)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details
Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein
MBS1471800-06 0.02 mg (Mammalian-Cell)

Recombinant Fowl adenovirus A serotype 1 Late L1 52 kDa protein

Ask
View Details