Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20) ; Capsid protein C; E (rns) glycoprotein; gp44/48) ; Envelope glycoprotein E1; gp33) ; Envelope glycoprotein E2; gp55) ; p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2) ; Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3) ; Non-structural protein 4A; NS4A) ; Non-structural protein 4B; NS4B) ; Non-structural protein 5A; NS5A) ; RNA-directed RNA polymerase; EC 2.7.7.48; NS5B) ]

Abbreviation

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial

UniProt

Q01499

Expression Region

1-168aa

Organism

Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)

Target Sequence

MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.P7 forms a leader sequence to properly orient NS2 in the membrane.Uncleaved NS2-3 is required for production of infectious virus.NS2 protease seems to play a vital role in viral RNA replication control and in the pathogenicity of the virus.NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase.NS4A is a cofactor for the NS3 protease activity.RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.0 kDa

References & Citations

"Structure of a pestivirus envelope glycoprotein E2 clarifies its role in cell entry." El Omari K., Iourin O., Harlos K., Grimes J.M., Stuart D.I. Cell Rep 3:30-35 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AP3 Protein Vector (Human) (pPM-C-HA)
PV075119 500 ng

EIF2AP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ptpn20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3408907 1.0 µg DNA

Ptpn20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human OBSCN Protein - (Dry Ice)
H00084033-Q01-10ug 10 µg

Recombinant Human OBSCN Protein - (Dry Ice)

Sign In for Pricing
View Details
Human Hexosaminidase B Beta ELISA Kit (HEXb)
RK01559 96 Tests

Human Hexosaminidase B Beta ELISA Kit (HEXb)

Sign In for Pricing
View Details
Anti-Pig IL10 Polyclonal Antibody
SB997024-01 50 µg

Anti-Pig IL10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Pig IL10 Polyclonal Antibody
SB997024-02 100 µg

Anti-Pig IL10 Polyclonal Antibody

Sign In for Pricing
View Details