Cardiotrophin-1/CTF1, Human (CHO)
Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.
Product Specifications
Product Name Alternative
Cardiotrophin-1/CTF1 Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Applications
Neuroscience-Neuromodulation
Assay Protocol
https://www.medchemexpress.com/cytokines/cardiotrophin-1-ctf1-protein-human-cho.html
Purity
95.0
Smiles
SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Molecular Formula
1489 (Gene_ID) Q16619-1 (S2-A201) (Accession)
Molecular Weight
24-26 kDa
References & Citations
[1]López-Yoldi M, et al. Role of cardiotrophin-1 in the regulation of metabolic circadian rhythms and adipose core clock genes in mice and characterization of 24-h circulating CT-1 profiles in normal-weight and overweight/obese subjects. FASEB J. 2017 Apr;31 (4) :1639-1649.|[2]Peng L, et al. Cardiotrophin-1 stimulates the neural differentiation of human umbilical cord blood-derived mesenchymal stem cells and survival of differentiated cells through PI3K/Akt-dependent signaling pathways. Cytotechnology. 2017 Dec;69 (6) :933-941.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880146-500 1x 500 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472302-500 1x 500 µL
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details