Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cardiotrophin-1/CTF1, Human (CHO)

Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.

Product Specifications

Product Name Alternative

Cardiotrophin-1/CTF1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/cardiotrophin-1-ctf1-protein-human-cho.html

Purity

95.0

Smiles

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Molecular Formula

1489 (Gene_ID) Q16619-1 (S2-A201) (Accession)

Molecular Weight

24-26 kDa

References & Citations

[1]López-Yoldi M, et al. Role of cardiotrophin-1 in the regulation of metabolic circadian rhythms and adipose core clock genes in mice and characterization of 24-h circulating CT-1 profiles in normal-weight and overweight/obese subjects. FASEB J. 2017 Apr;31 (4) :1639-1649.|[2]Peng L, et al. Cardiotrophin-1 stimulates the neural differentiation of human umbilical cord blood-derived mesenchymal stem cells and survival of differentiated cells through PI3K/Akt-dependent signaling pathways. Cytotechnology. 2017 Dec;69 (6) :933-941.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL14 Protein (N-His, Human)
P520739 100 µg

CCL14 Protein (N-His, Human)

Sign In for Pricing
View Details
Human G3BP1 Protein
orb425613-01 2 µg

Human G3BP1 Protein

Sign In for Pricing
View Details
Human G3BP1 Protein
orb425613-02 10 µg

Human G3BP1 Protein

Sign In for Pricing
View Details
Human G3BP1 Protein
orb425613-03 1 mg

Human G3BP1 Protein

Sign In for Pricing
View Details
Mouse Monoclonal GPRC5B Antibody (575926) [DyLight 680]
FAB10253Y 0.1 mL

Mouse Monoclonal GPRC5B Antibody (575926) [DyLight 680]

Sign In for Pricing
View Details
SPCS3 siRNA (Human)
MBS8223366-01 15 nmol

SPCS3 siRNA (Human)

Sign In for Pricing
View Details