Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36 beta/IL-1F8, Mouse

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.

Product Specifications

Product Name Alternative

IL-36 beta/IL-1F8 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36-beta-il-1f8-protein-mouse-153a-a.html

Purity

95.63

Smiles

SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

Molecular Formula

69677 (Gene_ID) Q9D6Z6 (S31-K183) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281 (1) :169-178.|[2]Zhou L, et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.|[3]Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25 (6) :458-65.|[4]Zhu J, et al. Interleukin-36β exacerbates DSS-induce acute colitis via inhibiting Foxp3+ regulatory T cell response and increasing Th2 cell response. Int Immunopharmacol. 2022 Jul;108:108762.|[5]Zhao X, et al. IL-36β Promotes CD8+ T Cell Activation and Antitumor Immune Responses by Activating mTORC1. Front Immunol. 2019 Aug 7;10:1803.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Xylose
TRC-X750750-500G 500 g

D-Xylose

Sign In for Pricing
View Details
Single Frequency type Ultrasonic Cleaner BULC-719
BULC-719 Each

Single Frequency type Ultrasonic Cleaner BULC-719

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559354 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF594 conjugate, 0.1mg/mL
BNC941576-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]
TA810729BM 100 µL

FAM131C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]

Sign In for Pricing
View Details
Synuclein γ Antibody
8C0334-AAT 50 µg

Synuclein γ Antibody

Sign In for Pricing
View Details