Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36 beta/IL-1F8, Mouse

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.

Product Specifications

Product Name Alternative

IL-36 beta/IL-1F8 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36-beta-il-1f8-protein-mouse-153a-a.html

Purity

95.63

Smiles

SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

Molecular Formula

69677 (Gene_ID) Q9D6Z6 (S31-K183) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281 (1) :169-178.|[2]Zhou L, et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.|[3]Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25 (6) :458-65.|[4]Zhu J, et al. Interleukin-36β exacerbates DSS-induce acute colitis via inhibiting Foxp3+ regulatory T cell response and increasing Th2 cell response. Int Immunopharmacol. 2022 Jul;108:108762.|[5]Zhao X, et al. IL-36β Promotes CD8+ T Cell Activation and Antitumor Immune Responses by Activating mTORC1. Front Immunol. 2019 Aug 7;10:1803.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WTAP Protein, Human, Recombinant (GST Tag)
PH51404E6 100 µg

WTAP Protein, Human, Recombinant (GST Tag)

Sign In for Pricing
View Details
SEC13L1 (SEC13) Human Over-expression Lysate
orb1340675 100 µg

SEC13L1 (SEC13) Human Over-expression Lysate

Sign In for Pricing
View Details
Mmu-miR-6925-5p agomir
HY-R03573A-01 5 nmol

Mmu-miR-6925-5p agomir

Sign In for Pricing
View Details
Mmu-miR-6925-5p agomir
HY-R03573A-02 20 nmol

Mmu-miR-6925-5p agomir

Sign In for Pricing
View Details
NETO2, NT (NETO2, BTCL2, Neuropilin and tolloid-like protein 2, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2) (MaxLight 550) discontinued
038901-ML550 100 µL

NETO2, NT (NETO2, BTCL2, Neuropilin and tolloid-like protein 2, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Yersinia pestis Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1329779-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details