CD30/TNFRSF8, Human (HEK293, His)
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD30/TNFRSF8 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his.html
Purity
98.0
Smiles
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Molecular Formula
943 (Gene_ID) P28908 (F19-K379) (Accession)
Molecular Weight
60-95 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15212483 1 Vial
Lentiviral mouse Spon2 shRNA (UAS) - Lentiviral mouse Spon2 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details MAB71263JF549 0.1 mL
Mouse Monoclonal VISTA/B7-H5/PD-1H Antibody (730823) [Janelia Fluor 549]
Sign In for Pricing
View Details 
GTR10423578 96 Well
Chicken Tumor Specific Growth Fanctor ELISA kit
Sign In for Pricing
View Details 
201-16-0056 96 Tests
Chicken follicle-stimulating hormone (FSH) ELISA Kit
Sign In for Pricing
View Details