Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENA-78/CXCL5, Human (HEK293)

CXCL5, also known as neutrophil activating peptide 78 (ENA‐78), is a CXC chemokine containing ELR motif. CXCL5 promotes angiogenesis through interaction with its specific receptor CXCR2. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, and non-immune cells including mesothelial cells, and fibroblasts.CXCL5/CXCR2 axis not only contributes to the recruitment of neutrophils but also regulates the function of neutrophils in melanoma[1][2]. ENA-78/CXCL5 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 78 amino acids (A37-N114) .

Product Specifications

Product Name Alternative

ENA-78/CXCL5 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ena-78-cxcl5-protein-human-hek293.html

Purity

98.0

Smiles

AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Molecular Formula

6374 (Gene_ID) P42830 (A37-N114) (Accession)

Molecular Weight

Approximately 8.5 kDa

References & Citations

[1]Kawamura M, et al. CXCL5, a promoter of cell proliferation, migration and invasion, is a novel serum prognostic marker in patients with colorectal cancer. Eur J Cancer. 2012 Sep;48 (14) :2244-51.|[2]Kawamura M, et al. CXCL5, a promoter of cell proliferation, migration and invasion, is a novel serum prognostic marker in patients with colorectal cancer. Eur J Cancer. 2012 Sep;48 (14) :2244-51.|[3]Wen Zhang, et al. CXCL5/CXCR2 axis in tumor microenvironment as potential diagnostic biomarker and therapeutic target. Cancer Commun (Lond) . 2020 Mar;40 (2-3) :69-80.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL
BNC042313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL
BNC741380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL
BNC882171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL
BNC472616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details