Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EpCAM/TROP1, Rat (HEK293, His)

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Rat (HEK293, His) is the recombinant rat-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EpCAM/TROP1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epcam-trop1-protein-rat-hek293-his.html

Purity

97.00

Smiles

QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLT

Molecular Formula

171577 (Gene_ID) O55159 (Q24-T266) (Accession)

Molecular Weight

Approximately 30-36 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2 (SARS Receptor) (N-term) Rabbit pAb
E2615653-01 100 µg

ACE2 (SARS Receptor) (N-term) Rabbit pAb

Sign In for Pricing
View Details
ACE2 (SARS Receptor) (N-term) Rabbit pAb
E2615653-02 100 µL

ACE2 (SARS Receptor) (N-term) Rabbit pAb

Sign In for Pricing
View Details
Standard Nutrient Agar No.1
92654-01 100 g

Standard Nutrient Agar No.1

Sign In for Pricing
View Details
Standard Nutrient Agar No.1
92654-02 500 g

Standard Nutrient Agar No.1

Sign In for Pricing
View Details
Goat glutamate receptor (NMDAR) ELISA Kit
EIA07298Go 1 Kit

Goat glutamate receptor (NMDAR) ELISA Kit

Sign In for Pricing
View Details
Sppl3 Protein Lysate (Human) with C-Ha Tag
45374031 100 µg

Sppl3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details