Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor Isoform 165; VEGF165

Abbreviation

Recombinant Human VEGF165 protein (Active)

Gene Name

VEGFA

UniProt

P15692-4

Expression Region

27-191aa

Organism

Homo sapiens (Human)

Target Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilicveinendothelial cells. The ED50 for this effect is 0.2-5 ng/mL

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform VEGF165

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JKAMP (NM_001284203) Human Tagged ORF Clone
RC236911 10 µg

JKAMP (NM_001284203) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [DyLight 650]
FAB3563W 0.1 mL

Rabbit Monoclonal HVEM/TNFRSF14 Antibody (2742B) [DyLight 650]

Sign In for Pricing
View Details
Csad Rat shRNA Plasmid (Locus ID 60356)
TR710502 1 Kit

Csad Rat shRNA Plasmid (Locus ID 60356)

Sign In for Pricing
View Details
Ammonium chloride pure EP, USP (pharma grade)
LC-7318.3 25 Kg

Ammonium chloride pure EP, USP (pharma grade)

Sign In for Pricing
View Details
DNA PK, Catalytic Subunit, multiple clones (DNA-dependent Protein Kinase) (BSA & Azide Free) (MaxLight 550) discontinued
D3949X-ML550 100 µL

DNA PK, Catalytic Subunit, multiple clones (DNA-dependent Protein Kinase) (BSA & Azide Free) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FNDC3A Blocking Peptide
MBS9633400-01 1 mg

FNDC3A Blocking Peptide

Sign In for Pricing
View Details