Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor Isoform 165; VEGF165

Abbreviation

Recombinant Human VEGF165 protein (Active)

Gene Name

VEGFA

UniProt

P15692-4

Expression Region

27-191aa

Organism

Homo sapiens (Human)

Target Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilicveinendothelial cells. The ED50 for this effect is 0.2-5 ng/mL

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform VEGF165

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPT1 Recombinant Protein
OPCD01295-10UG 10 µg

ANGPT1 Recombinant Protein

Sign In for Pricing
View Details
Scurfin Antibody / FOXP3
orb1822619 100 µg

Scurfin Antibody / FOXP3

Sign In for Pricing
View Details
Camel Protein Inhibitor of Activated Stat 1 ELISA Kit
MBS078106-01 48 Well

Camel Protein Inhibitor of Activated Stat 1 ELISA Kit

Sign In for Pricing
View Details
Camel Protein Inhibitor of Activated Stat 1 ELISA Kit
MBS078106-02 96 Well

Camel Protein Inhibitor of Activated Stat 1 ELISA Kit

Sign In for Pricing
View Details
Camel Protein Inhibitor of Activated Stat 1 ELISA Kit
MBS078106-03 5x 96 Well

Camel Protein Inhibitor of Activated Stat 1 ELISA Kit

Sign In for Pricing
View Details
Camel Protein Inhibitor of Activated Stat 1 ELISA Kit
MBS078106-04 10x 96 Well

Camel Protein Inhibitor of Activated Stat 1 ELISA Kit

Sign In for Pricing
View Details