Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zika virus E/Envelope (HEK293, His)

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Zika virus E/Envelope Protein (HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zika-virus-e-envelope-protein-biotinylated-hek293-his.html

Purity

95.00

Smiles

VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

Molecular Formula

/ (Gene_ID) ALU33341 (V593-K699) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb) . 2023 Jun 6;59 (46) :6946-6955.|[2]Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTHRC1 Recombinant Protein
PROTQ96CG8-100ug 100 µg

Human CTHRC1 Recombinant Protein

Sign In for Pricing
View Details
CCDC137 Conjugated Antibody
orb1614262 100 µL

CCDC137 Conjugated Antibody

Sign In for Pricing
View Details
ASIC1 Rabbit Polyclonal Antibody (PE)
orb2608662 100 µg

ASIC1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Anti-Rab5 Antibody
56415 1 Each

Anti-Rab5 Antibody

Sign In for Pricing
View Details
Sheep Alpha-1, 6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (MGAT2) ELISA Kit
MBS7214239-01 48 Well

Sheep Alpha-1, 6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (MGAT2) ELISA Kit

Sign In for Pricing
View Details
Sheep Alpha-1, 6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (MGAT2) ELISA Kit
MBS7214239-02 96 Well

Sheep Alpha-1, 6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (MGAT2) ELISA Kit

Sign In for Pricing
View Details