Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zika virus E/Envelope (HEK293, His)

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Zika virus E/Envelope Protein (HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zika-virus-e-envelope-protein-biotinylated-hek293-his.html

Purity

95.00

Smiles

VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

Molecular Formula

/ (Gene_ID) ALU33341 (V593-K699) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb) . 2023 Jun 6;59 (46) :6946-6955.|[2]Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASAL1, ID (RASAL1, RASAL, RasGAP-activating-like protein 1) (MaxLight 550) discontinued
040845-ML550 100 µL

RASAL1, ID (RASAL1, RASAL, RasGAP-activating-like protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PDE6H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36294061 1.0 µg DNA

PDE6H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pancreas Dissociation System 7 (Interlobular ducts), Mouse and Rat
4-20377 Each

Pancreas Dissociation System 7 (Interlobular ducts), Mouse and Rat

Sign In for Pricing
View Details
Phospho-AKT1S1-T246 pAb
E9P0793 100 µL

Phospho-AKT1S1-T246 pAb

Sign In for Pricing
View Details
CD137 Antibody / 4-1BB / TNFRSF9
orb2642760 100 µg

CD137 Antibody / 4-1BB / TNFRSF9

Sign In for Pricing
View Details
Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP) (MaxLight 405) discontinued
135189-ML405 100 µL

Utrophin (UTRN, Dystrophin-related Protein 1, DRP1, DRP-1, DMDL, DRP) (MaxLight 405) discontinued

Sign In for Pricing
View Details