S100A2, Human (HEK293, hFc)
Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
S100A2 Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a2-protein-human-hek293-hfc.html
Purity
96.00
Smiles
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Molecular Formula
6273 (Gene_ID) NP_005969.1 (M2-P98) (Accession)
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
UBE2D3, Recombinant, Human, His-tag (Ubiquitin-conjugating Enzyme E2 D3, UBC5C, UBCH5C, Ubiquitin Carrier Protein D3, Ubiquitin-conjugating Enzyme E2(17)KB 3, Ubiquitin-conjugating Enzyme E2-17kD 3, Ubiquitin-protein Ligase D3)
UBE2D3, Recombinant, Human, His-tag (Ubiquitin-conjugating Enzyme E2 D3, UBC5C, UBCH5C, Ubiquitin Carrier Protein D3, Ubiquitin-conjugating Enzyme E2(17)KB 3, Ubiquitin-conjugating Enzyme E2-17kD 3, Ubiquitin-protein Ligase D3)