Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human (HEK293, hFc)

Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100A2 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human-hek293-hfc.html

Purity

96.00

Smiles

MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) NP_005969.1 (M2-P98) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NDUFB6 Antibody
A29539-100UL 100 µL

NDUFB6 Antibody

Ask
View Details
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 550)
128202-ML550 100 µL

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 550)

Ask
View Details
Distribution Pump for BI Tank 230V
ZBIDIST51 1 Each

Distribution Pump for BI Tank 230V

Ask
View Details
RAB8A Antibody (YA7298, Rabbit)
HY-P87614 1 Each

RAB8A Antibody (YA7298, Rabbit)

Ask
View Details
Glycyrrhizic Acid Impurity 42
RM-G121842-01 10 mg

Glycyrrhizic Acid Impurity 42

Ask
View Details
Glycyrrhizic Acid Impurity 42
RM-G121842-02 100 mg

Glycyrrhizic Acid Impurity 42

Ask
View Details