Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human (HEK293, hFc)

Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100A2 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human-hek293-hfc.html

Purity

96.00

Smiles

MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) NP_005969.1 (M2-P98) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SSR2 Knockout HEK293T cell line
GTR15409407 1 Vial

Human SSR2 Knockout HEK293T cell line

Ask
View Details
FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2134038-01 0.1 mL

FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Ask
View Details
FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2134038-02 0.2 mL

FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Ask
View Details
FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2134038-03 0.5 mL

FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Ask
View Details
FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2134038-04 1 mL

FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Ask
View Details
FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2134038-05 5 mL

FITC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Ask
View Details