Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A2, Human (HEK293, hFc)

Protein S100-A2 (S100A2) is a member of the S100 family. S100A2 is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes. S100A2 may function as calcium sensor and modulator, contributing to cellular calcium signaling or function by interacting with other proteins and indirectly play a role in many physiological processes. S100A2 may also play a role in suppressing tumor cell growth. S100A2 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A2 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100A2 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a2-protein-human-hek293-hfc.html

Purity

96.00

Smiles

MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Molecular Formula

6273 (Gene_ID) NP_005969.1 (M2-P98) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC9A3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
44296061 1.0 µg DNA

SLC9A3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
LYPLAL1 Antibody, FITC conjugated
A58022-100UG 100 µg

LYPLAL1 Antibody, FITC conjugated

Ask
View Details
BTNL9 siRNA (Human)
CRJ5773-01 15 nmol

BTNL9 siRNA (Human)

Ask
View Details
BTNL9 siRNA (Human)
CRJ5773-02 30 nmol

BTNL9 siRNA (Human)

Ask
View Details
RTN2 (Reticulon-2, Neuroendocrine-specific Protein-like 1, NSP-like Protein 1, Neuroendocrine-specific Protein-like I, NSP-like Protein I, NSPLI, NSPL1) (HRP)
132877-HRP 100 µL

RTN2 (Reticulon-2, Neuroendocrine-specific Protein-like 1, NSP-like Protein 1, Neuroendocrine-specific Protein-like I, NSP-like Protein I, NSPLI, NSPL1) (HRP)

Ask
View Details
Rabbit Polyclonal GOLGB1/Giantin Antibody [DyLight 755]
NBP2-22321IR 0.1 mL

Rabbit Polyclonal GOLGB1/Giantin Antibody [DyLight 755]

Ask
View Details