Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA1/Serum Amyloid A-1, Mouse (His)

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse (His) is the recombinant mouse-derived SAA1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA1/Serum Amyloid A-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa1-protein-mouse-his.html

Purity

97.00

Smiles

GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Molecular Formula

20208 (Gene_ID) P05366 (G20-Y122) (Accession)

Molecular Weight

Approximately 13-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP)
MBS6151221-01 0.1 mL

AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP)

Ask
View Details
AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP)
MBS6151221-02 5x 0.1 mL

AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP)

Ask
View Details
Platelet-derived growth factor receptor beta (PDGFRB) polyclonal antibody
ABP-PAB-10947 100 ug

Platelet-derived growth factor receptor beta (PDGFRB) polyclonal antibody

Ask
View Details
Cdk4 Antibody
GWB-4B3B28 0.1 mg

Cdk4 Antibody

Ask
View Details
Goat anti Human J chain of dimeric IgA, conjugated with Horseradish peroxidase
MBS571594-01 1 mL

Goat anti Human J chain of dimeric IgA, conjugated with Horseradish peroxidase

Ask
View Details
Goat anti Human J chain of dimeric IgA, conjugated with Horseradish peroxidase
MBS571594-02 5x 1 mL

Goat anti Human J chain of dimeric IgA, conjugated with Horseradish peroxidase

Ask
View Details