Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA1/Serum Amyloid A-1, Mouse (His)

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse (His) is the recombinant mouse-derived SAA1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SAA1/Serum Amyloid A-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/saa1-protein-mouse-his.html

Purity

97.00

Smiles

GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Molecular Formula

20208 (Gene_ID) P05366 (G20-Y122) (Accession)

Molecular Weight

Approximately 13-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal Coagulation Factor XIV/Protein C Antibody (3W3R7)
NBP3-16427-100ul 100 µL

Rabbit Monoclonal Coagulation Factor XIV/Protein C Antibody (3W3R7)

Ask
View Details
USP13 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49282154 3x 1.0 µg DNA

USP13 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Ask
View Details
SMUBP2 (IGHMBP2) Human shRNA Plasmid Kit (Locus ID 3508)
TL312214 1 Kit

SMUBP2 (IGHMBP2) Human shRNA Plasmid Kit (Locus ID 3508)

Ask
View Details
ITGB1 Antibody
E30AC1768 100 µL

ITGB1 Antibody

Ask
View Details
Nerve Growth Factor Receptor IgG2a Fc, Fusion Protein (NGFR, Neurotrophin Receptor, NTR) (Preservative Free)
N2050-12CX 25 µg

Nerve Growth Factor Receptor IgG2a Fc, Fusion Protein (NGFR, Neurotrophin Receptor, NTR) (Preservative Free)

Ask
View Details