Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 5 (CCL5)

Product Specifications

Product Name Alternative

EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228 ; TCP228T-cell-specific protein RANTES

Abbreviation

Recombinant Human CCL5 protein

Gene Name

CCL5

UniProt

P13501

Expression Region

24-91aa

Organism

Homo sapiens (Human)

Target Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) . The processed form RANTES (3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES (4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES (1-68) and RANTES (3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP5L Recombinant Protein Antigen
NBP1-81381PEP 0.1 mL

SH3BP5L Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)
MBS969005-01 0.05 mL

Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)

Sign In for Pricing
View Details
Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)
MBS969005-02 0.1 mL

Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)

Sign In for Pricing
View Details
Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)
MBS969005-03 5x 0.1 mL

Rabbit anti-human Cystatin-SN polyclonal Antibody(CST1)

Sign In for Pricing
View Details
Genorise® Recombinant human Haptoglobin-α2 protein
GR119051 5 µg

Genorise® Recombinant human Haptoglobin-α2 protein

Sign In for Pricing
View Details
Rabbit Polyclonal PSF3 Antibody
NBP3-12589-50ul 50 µL

Rabbit Polyclonal PSF3 Antibody

Sign In for Pricing
View Details