Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-15 receptor subunit alpha (Il15ra), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-15 receptor subunit alpha; Il15ra; sIL-15 receptor subunit alpha

Abbreviation

Recombinant Mouse Il15ra protein, partial (Active)

Gene Name

Il15ra

UniProt

Q60819

Expression Region

33-205aa

Organism

Mus musculus (Mouse)

Target Sequence

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK

Tag

C-terminal Fc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.5-2 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity) .

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH12 (NM_016580) Human Recombinant Protein
TP323041M 100 µg

PCDH12 (NM_016580) Human Recombinant Protein

Sign In for Pricing
View Details
SMURF1 Antibody
KC-29199-01 50 μL

SMURF1 Antibody

Sign In for Pricing
View Details
SMURF1 Antibody
KC-29199-02 100 µL

SMURF1 Antibody

Sign In for Pricing
View Details
SMURF1 Antibody
KC-29199-03 1 mL

SMURF1 Antibody

Sign In for Pricing
View Details
N-Ethylsuccinimide
TRC-E925960-1G 1 g

N-Ethylsuccinimide

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin 2/PRDX2 Protein (His Tag)
PKSH031179 100 µg

Recombinant Human Peroxiredoxin 2/PRDX2 Protein (His Tag)

Sign In for Pricing
View Details