Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-7, Human

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human is the recombinant human-derived IL-7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GMP IL-7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-7-protein-human.html

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1/NP_000871.1 (D26-H177) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]
MBS2579652-01 50 Tests

Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]

Ask
View Details
Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]
MBS2579652-02 100 Tests

Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]

Ask
View Details
Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]
MBS2579652-03 2x 100 Tests

Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]

Ask
View Details
Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]
MBS2579652-04 10x 100 Tests

Fluor700 Anti-Mouse/Rat CD29 Antibody [HMbeta1-1]

Ask
View Details
RND2 Human shRNA Lentiviral Particle (Locus ID 8153)
TL316799V 500 µL Each

RND2 Human shRNA Lentiviral Particle (Locus ID 8153)

Ask
View Details
EPHA3 Rabbit pAb (APR28201N)
APR28201N-01 50 µL

EPHA3 Rabbit pAb (APR28201N)

Ask
View Details