Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-7, Human

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. GMP IL-7 Protein, Human is the recombinant human-derived IL-7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GMP IL-7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-7-protein-human.html

Smiles

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Formula

3574 (Gene_ID) P13232-1/NP_000871.1 (D26-H177) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal Cystatin E/M/CST6 Antibody (022) [Janelia Fluor 646]
NBP2-89499JF646 0.1 mL

Rabbit Monoclonal Cystatin E/M/CST6 Antibody (022) [Janelia Fluor 646]

Ask
View Details
ATG4A Mouse Monoclonal Antibody
AMM82108-01 1 Each

ATG4A Mouse Monoclonal Antibody

Ask
View Details
ATG4A Mouse Monoclonal Antibody
AMM82108-02 50 µL

ATG4A Mouse Monoclonal Antibody

Ask
View Details
ATG4A Mouse Monoclonal Antibody
AMM82108-03 100 µL

ATG4A Mouse Monoclonal Antibody

Ask
View Details
PHACTR2 (Phosphatase and Actin Regulator 2, C6orf56, DKFZp686F18175, KIAA0680, MGC176642) (AP)
MBS6132905-01 0.1 mL

PHACTR2 (Phosphatase and Actin Regulator 2, C6orf56, DKFZp686F18175, KIAA0680, MGC176642) (AP)

Ask
View Details
PHACTR2 (Phosphatase and Actin Regulator 2, C6orf56, DKFZp686F18175, KIAA0680, MGC176642) (AP)
MBS6132905-02 5x 0.1 mL

PHACTR2 (Phosphatase and Actin Regulator 2, C6orf56, DKFZp686F18175, KIAA0680, MGC176642) (AP)

Ask
View Details