Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Mouse (HEK293, His, solution)

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-mouse-221a-a-hek293-his.html

Purity

97.0

Smiles

KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

Molecular Formula

12523 (Gene_ID) Q18PI6-1 (K22-V221) (Accession)

Molecular Weight

37-42 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steady-LucTM Firefly HTS Assay Kit, 120 Assays
#30028-1 1 Kit

Steady-LucTM Firefly HTS Assay Kit, 120 Assays

Sign In for Pricing
View Details
ADCY5 Human Gene Knockout Kit (CRISPR)
KN222906LP 1 Kit

ADCY5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Traesolide
TRC-T704500-50MG 50 mg

Traesolide

Sign In for Pricing
View Details
Mouse CamL activation kit by CRISPRa
GA200508 1 Kit

Mouse CamL activation kit by CRISPRa

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/2985), CF405S conjugate, 0.1mg/mL
BNC042985-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/2985), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF647 conjugate, 0.1mg/mL
BNC471829-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details