Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Mouse (HEK293, His, solution)

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-mouse-221a-a-hek293-his.html

Purity

97.0

Smiles

KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

Molecular Formula

12523 (Gene_ID) Q18PI6-1 (K22-V221) (Accession)

Molecular Weight

37-42 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis homeobox 3 (MEIS3) (NM_001009813) Human Over-expression Lysate
LC422933 20 µg

Meis homeobox 3 (MEIS3) (NM_001009813) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Swine FGF-2 protein (His Tag)
PKSS000016-01 5 µg

Recombinant Swine FGF-2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine FGF-2 protein (His Tag)
PKSS000016-02 20 µg

Recombinant Swine FGF-2 protein (His Tag)

Sign In for Pricing
View Details
STYK1 (NM_018423) Human Over-expression Lysate
LY402684 100 µg

STYK1 (NM_018423) Human Over-expression Lysate

Sign In for Pricing
View Details
Furin Antibody
KC-7384-01 50 μL

Furin Antibody

Sign In for Pricing
View Details
Furin Antibody
KC-7384-02 100 µL

Furin Antibody

Sign In for Pricing
View Details