CD84/SLAMF5, Mouse (HEK293, His, solution)
CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.
Product Specifications
Product Name Alternative
CD84/SLAMF5 Protein, Mouse (HEK293, His, solution), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-mouse-221a-a-hek293-his.html
Purity
97.0
Smiles
KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV
Molecular Formula
12523 (Gene_ID) Q18PI6-1 (K22-V221) (Accession)
Molecular Weight
37-42 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
243265-FITC 100 µL
ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (FITC)
Sign In for Pricing
View Details 
36902114 3x 1.0 µg
Pla2g15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details EKN47654 96 Tests
Rat Peripheral Myelin Protein 22 (PMP22) ELISA Kit
Sign In for Pricing
View Details 031607-ML490 100 µL
ADAM8, NT (ADAM8, MS2, Disintegrin and metalloproteinase domain-containing protein 8, Cell surface antigen MS2, CD156a) (MaxLight 490) discontinued
Sign In for Pricing
View Details