Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C chemokine receptor type 2 (Ccr2), partial

Product Specifications

Product Name Alternative

(C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC receptor) (MCP-1 receptor) (CD antigen CD192)

Abbreviation

Recombinant Mouse Ccr2 protein, partial

Gene Name

Ccr2

UniProt

P51683

Expression Region

1-55aa

Organism

Mus musculus (Mouse)

Target Sequence

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Key functional receptor for CCL2 but can also bind CCL7 and CCL12 chemokines. Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion. Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B. Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation. Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R. Plays an important role in mediating peripheral nerve injury-induced neuropathic pain. Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Mediates the recruitment of macrophages and monocytes to the injury site following brain injury.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.6 kDa

References & Citations

"Chemokine receptor CCR2 contributes to neuropathic pain and the associated depression via increasing NR2B-mediated currents in both D1 and D2 dopamine receptor-containing medium spiny neurons in the nucleus accumbens shell." Wu X.B., Jing P.B., Zhang Z.J., Cao D.L., Gao M.H., Jiang B.C., Gao Y.J. Neuropsychopharmacology 43:2320-2330 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Fibronectin (FN) AssayMax™ ELISA Kit
EF1045-1 96 Well

Human Fibronectin (FN) AssayMax™ ELISA Kit

Ask
View Details
Myl12a Mouse qPCR Primer Pair (NM_026064)
MP213672 200 Reactions

Myl12a Mouse qPCR Primer Pair (NM_026064)

Ask
View Details
Abhd16b Mouse qPCR Primer Pair (NM_183181)
MP202157 200 Reactions

Abhd16b Mouse qPCR Primer Pair (NM_183181)

Ask
View Details
Rabbit Polyclonal VTI1A Antibody [mFluor Violet 610 SE]
NBP2-81876MFV610 0.1 mL

Rabbit Polyclonal VTI1A Antibody [mFluor Violet 610 SE]

Ask
View Details
Protein FAM3D (FAM3D) Antibody
abx456788-01 50 µg

Protein FAM3D (FAM3D) Antibody

Ask
View Details
Protein FAM3D (FAM3D) Antibody
abx456788-02 100 µg

Protein FAM3D (FAM3D) Antibody

Ask
View Details