Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Mouse (HEK293, His)

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 175 amino acids (N27-W201) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-mouse-hek-293-his.html

Purity

96

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 28-39 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[2]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[3]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[4]Sheng Zuo, et al. CXCL16 Induces the Progression of Pulmonary Fibrosis through Promoting the Phosphorylation of STAT3. Can Respir J. 2019 Jul 10;2019:2697376.|[5]Yi Gong, et al. Prognostic and pathogenic role of CXC motif ligand 16 in sepsis. Microbes Infect. 2022 Feb;24 (1) :104882.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFT140 shRNA Plasmid
abx956509-01 150 µg

Human IFT140 shRNA Plasmid

Sign In for Pricing
View Details
Human IFT140 shRNA Plasmid
abx956509-02 300 µg

Human IFT140 shRNA Plasmid

Sign In for Pricing
View Details
Anti-METTL1 antibody
STJ26517 100 µl

Anti-METTL1 antibody

Sign In for Pricing
View Details
Human MBD3L1 knockdown cell line
ABC-KD9072 1 Vial

Human MBD3L1 knockdown cell line

Sign In for Pricing
View Details
Human SLC5A4 activation kit by CRISPRa
GA104451 1 Kit

Human SLC5A4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human PLA2R1 Protein
XC624012-01 50 µg

Recombinant Human PLA2R1 Protein

Sign In for Pricing
View Details