Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Mouse (HEK293, His)

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 175 amino acids (N27-W201) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-mouse-hek-293-his.html

Purity

96

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-W201) (Accession)

Molecular Weight

Approximately 28-39 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[2]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[3]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[4]Sheng Zuo, et al. CXCL16 Induces the Progression of Pulmonary Fibrosis through Promoting the Phosphorylation of STAT3. Can Respir J. 2019 Jul 10;2019:2697376.|[5]Yi Gong, et al. Prognostic and pathogenic role of CXC motif ligand 16 in sepsis. Microbes Infect. 2022 Feb;24 (1) :104882.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5P8 ORF Vector (Human) (pORF)
ORF030918 1.0 µg DNA

RPL5P8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Vmn1r19 qPCR Primer Pair
QM52742S 200 Tests

Mouse Vmn1r19 qPCR Primer Pair

Sign In for Pricing
View Details
Ocm (NM_033039) Mouse Tagged ORF Clone
MG224288 10 µg

Ocm (NM_033039) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BTN3A2 CRISPRa sgRNA lentivector (set of three targets)(Human)
13565121 3x 1.0µg DNA

BTN3A2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anamorelin HCl 1mg
A12345-1 1 mg

Anamorelin HCl 1mg

Sign In for Pricing
View Details
Recombinant Clostridium tetani Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1302576-01 0.02 mg (E-Coli)

Recombinant Clostridium tetani Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details