Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIM-3/HAVCR2, Mouse (HEK293, Fc)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TIM-3/HAVCR2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tim-3-havcr2-protein-mouse-172a-a-hek293-fc.html

Purity

95.00

Smiles

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR

Molecular Formula

171285 (Gene_ID) Q8VIM0-1 (R20-R191) (Accession)

Molecular Weight

50-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BMAL1 Rabbit Monoclonal Antibody
MA1481-.05 50 µL

Anti-BMAL1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TG101209 100mg
A11180-100 100 mg

TG101209 100mg

Sign In for Pricing
View Details
ZC3H12C Rabbit Polyclonal Antibody
orb186615-01 50 μL

ZC3H12C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZC3H12C Rabbit Polyclonal Antibody
orb186615-02 100 µL

ZC3H12C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZC3H12C Rabbit Polyclonal Antibody
orb186615-03 200 µL

ZC3H12C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF2B4 Antibody - middle region (Phospho-K161)
OAAB07466-400UL 400 µL

EIF2B4 Antibody - middle region (Phospho-K161)

Sign In for Pricing
View Details