Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Rat (HEK293, His)

The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Rat (HEK293, His) is the recombinant rat-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-rat-hek293-his.html

Purity

97.00

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAYCIACPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDTHTLPPKE

Molecular Formula

296872 (Gene_ID) A0A096MJP5 (M2-E137) (Accession)

Molecular Weight

Approximately 24 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAP1 Antibody - N-terminal region (ARP66933_P050)
ARP66933_P050 100 µL

RPAP1 Antibody - N-terminal region (ARP66933_P050)

Sign In for Pricing
View Details
DSCAM-IT1 Protein Vector (Human) (pPM-C-His)
PV074136 500 ng

DSCAM-IT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CHAF1B 3'UTR GFP Stable Cell Line
TU054315 1.0 mL

CHAF1B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
COQ6 Recombinant Protein (Human)
RP007729 100 µg

COQ6 Recombinant Protein (Human)

Sign In for Pricing
View Details
Galt Rat siRNA Oligo Duplex (Locus ID 298003)
SR502064 1 Kit

Galt Rat siRNA Oligo Duplex (Locus ID 298003)

Sign In for Pricing
View Details
Yttrium (III) Oxide extrapure AR, 99.9%
46561-01 10 g

Yttrium (III) Oxide extrapure AR, 99.9%

Sign In for Pricing
View Details