Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A11, Mouse (His)

The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity.As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions.S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A11 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a11-protein-mouse-his.html

Purity

98.0

Smiles

MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI

Molecular Formula

20195 (Gene_ID) P50543 (M1-I98) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF640R conjugate, 0.1mg/mL
BNC400644-500 1x 500 µL

TGFalpha (MF9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
BNC040729-500 1x 500 µL

Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF594 conjugate, 0.1mg/mL
BNC942029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details