Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYVE-1, Mouse (HEK293, Fc)

The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LYVE-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

LYVE-1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lyve-1-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG

Molecular Formula

114332 (Gene_ID) Q8BHC0 (A24-G228) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Myofibroblast Marker Antibody (PR 2D3) [DyLight 594]
NBP2-50524DL594 0.1 mL

Mouse Monoclonal Myofibroblast Marker Antibody (PR 2D3) [DyLight 594]

Sign In for Pricing
View Details
Rat Hepatoma Carcinoma Cell Line-CBRH7919
CC7F143 1x 10^6 Cells/Vial

Rat Hepatoma Carcinoma Cell Line-CBRH7919

Sign In for Pricing
View Details
GENLISA™ Human 5 - Nucleotidase (5 - NT) ELISA
KBH0831 1x 96 Well

GENLISA™ Human 5 - Nucleotidase (5 - NT) ELISA

Sign In for Pricing
View Details
Recombinant Mouse IL-1R1
Pr22492-01 10 µg

Recombinant Mouse IL-1R1

Sign In for Pricing
View Details
Recombinant Mouse IL-1R1
Pr22492-02 50 µg

Recombinant Mouse IL-1R1

Sign In for Pricing
View Details
Recombinant Mouse IL-1R1
Pr22492-03 500 µg

Recombinant Mouse IL-1R1

Sign In for Pricing
View Details