MDC/CCL22, Mouse (His, solution)

CCL22/MDC Protein, Mouse (His) is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli with a his tag[1][2].

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdc-ccl22-protein-mouse.html

Purity

98.0

Smiles

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Molecular Formula

20299 (Gene_ID) O88430 (G25-S92) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27 (2) :152-6.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[4]Vanessa Pinho, et al. The role of CCL22 (MDC) for the recruitment of eosinophils during allergic pleurisy in mice. J Leukoc Biol. 2003 Mar;73 (3) :356-62.|[5]Jillian R Richter, et al. Macrophage-derived chemokine (CCL22) is a novel mediator of lung inflammation following hemorrhage and resuscitation. Shock. 2014 Dec;42 (6) :525-31.