Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTAQ1, Human (GST)

NTAQ1 Protein is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases. NTAQ1 Protein, Human (GST) is the recombinant human-derived NTAQ1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

NTAQ1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ntaq1-protein-human-gst.html

Smiles

MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC

Molecular Formula

55093 (Gene_ID) AAH08781.1 (M1-C205) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PCDHB14 (Protocadherin beta-14, PCDH-beta-14, MGC120065, PCDH-BETA14) (MaxLight 490)
MBS6202346-01 0.1 mL

PCDHB14 (Protocadherin beta-14, PCDH-beta-14, MGC120065, PCDH-BETA14) (MaxLight 490)

Ask
View Details
PCDHB14 (Protocadherin beta-14, PCDH-beta-14, MGC120065, PCDH-BETA14) (MaxLight 490)
MBS6202346-02 5x 0.1 mL

PCDHB14 (Protocadherin beta-14, PCDH-beta-14, MGC120065, PCDH-BETA14) (MaxLight 490)

Ask
View Details
Human GLB1L3 Pre-designed siRNA Set B
SI006288B 1 Each

Human GLB1L3 Pre-designed siRNA Set B

Ask
View Details
GPRIN3 Knockout HEK293T Polyclonal Cells
ARG38060 1 Million

GPRIN3 Knockout HEK293T Polyclonal Cells

Ask
View Details
Adenosine A2A-R shRNA (h) Lentiviral Particles
sc-39850-V 200 µL

Adenosine A2A-R shRNA (h) Lentiviral Particles

Ask
View Details
Rabbit Polyclonal NLRP9 Antibody [Alexa Fluor 405]
NBP2-82080AF405 0.1 mL

Rabbit Polyclonal NLRP9 Antibody [Alexa Fluor 405]

Ask
View Details