Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTAQ1, Human (GST)

NTAQ1 Protein is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases. NTAQ1 Protein, Human (GST) is the recombinant human-derived NTAQ1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

NTAQ1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ntaq1-protein-human-gst.html

Smiles

MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC

Molecular Formula

55093 (Gene_ID) AAH08781.1 (M1-C205) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human B-Cell Linker Protein (BLNK) ELISA Kit
abx354317-01 96 Tests

Human B-Cell Linker Protein (BLNK) ELISA Kit

Ask
View Details
Human B-Cell Linker Protein (BLNK) ELISA Kit
abx354317-02 5x 96 Tests

Human B-Cell Linker Protein (BLNK) ELISA Kit

Ask
View Details
Human B-Cell Linker Protein (BLNK) ELISA Kit
abx354317-03 10x 96 Tests

Human B-Cell Linker Protein (BLNK) ELISA Kit

Ask
View Details
7-Formyloxy Glycochenodeoxycholic Acid-d5 Ethyl Ester
TRC-F700932-1MG 1 mg

7-Formyloxy Glycochenodeoxycholic Acid-d5 Ethyl Ester

Ask
View Details
CD8 (CD 8, CD8 Antigen alpha Polypeptide, Leu2 T Lymphocyte Antigen, MAL, OKT8 T Cell Antigen, p32, T Cell Antigen Leu2, T Cell Surface Glycoprotein CD8 alpha Chain) (APC)
MBS6268610-01 0.1 mL

CD8 (CD 8, CD8 Antigen alpha Polypeptide, Leu2 T Lymphocyte Antigen, MAL, OKT8 T Cell Antigen, p32, T Cell Antigen Leu2, T Cell Surface Glycoprotein CD8 alpha Chain) (APC)

Ask
View Details
CD8 (CD 8, CD8 Antigen alpha Polypeptide, Leu2 T Lymphocyte Antigen, MAL, OKT8 T Cell Antigen, p32, T Cell Antigen Leu2, T Cell Surface Glycoprotein CD8 alpha Chain) (APC)
MBS6268610-02 5x 0.1 mL

CD8 (CD 8, CD8 Antigen alpha Polypeptide, Leu2 T Lymphocyte Antigen, MAL, OKT8 T Cell Antigen, p32, T Cell Antigen Leu2, T Cell Surface Glycoprotein CD8 alpha Chain) (APC)

Ask
View Details