Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 3 subunit F (EIF3F), partial

Product Specifications

Product Name Alternative

Deubiquitinating enzyme eIF3f (EC:3.4.19.12)

Abbreviation

Recombinant Human EIF3F protein, partial

Gene Name

EIF3F

UniProt

O00303

Expression Region

1-323aa

Organism

Homo sapiens (Human)

Target Sequence

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDF

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC) . The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassbly and recycling of post-termination ribosomal complexes and subsequently prevents prature joining of the 40S and 60S ribosomal subunits prior to initiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis

Molecular Weight

60.7 kDa

References & Citations

Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.Asano K., Vornlocher H.-P., Richter-Cook N.J., Merrick W.C., Hinnebusch A.G., Hershey J.W.B.J. Biol. Chem. 272:27042-27052 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deethylcyanazine acid
TRC-D953500-50MG 50 mg

Deethylcyanazine acid

Sign In for Pricing
View Details
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Over-expression Lysate
LY400284 100 µg

GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Over-expression Lysate

Sign In for Pricing
View Details
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA369676 100 µL

14-3-3 sigma (SFN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIM kinase 2 (LIMK2) pThr505 Rabbit Polyclonal Antibody
AP01629PU-N 100 µg

LIM kinase 2 (LIMK2) pThr505 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-01 50 μL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-02 100 µL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details