TSLP, Cynomolgus (His)
Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation.
Product Specifications
Product Name Alternative
TSLP Protein, Cynomolgus (His), Cynomolgus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tslp-protein-cynomolgus-his.html
Smiles
YDFTNCDFEKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Molecular Formula
102119254 (Gene_ID) XP_005557555.1 (Y29-Q159, Q37E) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog