Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Cynomolgus (His)

Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation.

Product Specifications

Product Name Alternative

TSLP Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-cynomolgus-his.html

Smiles

YDFTNCDFEKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Molecular Formula

102119254 (Gene_ID) XP_005557555.1 (Y29-Q159, Q37E) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naphthalene-d8
TRC-N345604-5G 5 g

Naphthalene-d8

Sign In for Pricing
View Details
Recombinant Human CMBL Protein (His Tag)
PKSH031130 100 µg

Recombinant Human CMBL Protein (His Tag)

Sign In for Pricing
View Details
Acetyl-CoA Carboxylase (ACC) Activity Assay Kit
E-BC-K508-M 96 T (40 samples)

Acetyl-CoA Carboxylase (ACC) Activity Assay Kit

Sign In for Pricing
View Details
Prr15l (NM_146026) Mouse Tagged ORF Clone
MG200303 10 µg

Prr15l (NM_146026) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF488A conjugate, 0.1mg/mL
BNC881707-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CD62L Monoclonal Antibody
AN301484L-01 50 µL

Recombinant CD62L Monoclonal Antibody

Sign In for Pricing
View Details