Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Cynomolgus (His)

Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation.

Product Specifications

Product Name Alternative

TSLP Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-cynomolgus-his.html

Smiles

YDFTNCDFEKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Molecular Formula

102119254 (Gene_ID) XP_005557555.1 (Y29-Q159, Q37E) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF1 Rabbit Polyclonal Antibody
TA372463 100 µL

KLF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD28 (37.51) In Vivo Antibody - Ultra-Low Endotoxin
ICH1055UL-100mg 100 mg

Anti-Mouse CD28 (37.51) In Vivo Antibody - Ultra-Low Endotoxin

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]
TA803281AM 100 µL

TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]

Sign In for Pricing
View Details
MS4A7 (NM_206939) Human Recombinant Protein
TP312066M 100 µg

MS4A7 (NM_206939) Human Recombinant Protein

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF640R conjugate, 0.1mg/mL
BNC400172-500 1x 500 µL

CD45 / LCA (135-4C5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GI24 (C10orf54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B8]
TA812252AM 100 µL

GI24 (C10orf54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B8]

Sign In for Pricing
View Details