Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus 3 beta-hydroxysteroid dehydrogenase/Delta 5——》4-isomerase (VACWR170)

Product Specifications

Product Name Alternative

(3-beta-HSD) (5) (3-beta-hydroxy-5-ene steroid dehydrogenase) (Progesterone reductase) (Delta-5-3-ketosteroid isomerase)

Abbreviation

Recombinant Vaccinia virus VACWR170 protein

Gene Name

VACWR170

UniProt

P26670

Expression Region

1-346aa

Organism

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Target Sequence

MAVYAVTGGAGFLGRYIVKLLISADDVQEIRVIDIVEDPQPITSKVKVINYIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGIKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVYAKSKRMAEQLVMKANNSVIMNGAKLYTCCLRPTGIYGEGDKLTKVFYEQCKQHGNIMYRTVDDDAVHSRVYVGNVAWMHVLAAKYIQYPGSEIKGNAYFCYDYSPSCSYDMFNLLLMKPLGIEQGSRIPRWMLKMYACKNDMKRILFRKPSLLNNYTLKISNTTFEVRTNNAELDFNYSPIFNVDVAFERTRKWLEESE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the oxidative conversion of Delta (5) -ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. During viral infection, steroid production contributes to virulence by inhibiting the host inflammatory response.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.9 kDa

References & Citations

"Effect of 3-beta-hydroxysteroid dehydrogenase gene deletion on virulence and immunogenicity of different vaccinia viruses and their recombinants." Sroller V., Kutinova L., Nemeckova S., Simonova V., Vonka V. Arch. Virol. 143:1311-1320 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAYN, His tagged
LAYN-796H 20 µg

Recombinant Human LAYN, His tagged

Sign In for Pricing
View Details
MLLT1 Rabbit Polyclonal Antibody (C-term)
E28PB2370 100 µL

MLLT1 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Olfactory Receptor 56A3
326803-01 50 µg

Olfactory Receptor 56A3

Sign In for Pricing
View Details
Olfactory Receptor 56A3
326803-02 100 µg

Olfactory Receptor 56A3

Sign In for Pricing
View Details
Calibration kit, 0NTU,100ml/bottle
932001 1 Each

Calibration kit, 0NTU,100ml/bottle

Sign In for Pricing
View Details
Opa3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6436402 1.0 µg DNA

Opa3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details