Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 1/TGFB1, Mouse/Rat (HEK293, Tag Free)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free) is a recombinant protein (A279-S390) produced by HEK293 cells[1][2].

Product Specifications

Product Name Alternative

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free), Rat; Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

TGF-beta/Smad

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-beta-1-tgfb1-protein-mouse-hek293.html

Purity

98.00

Smiles

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Formula

21803/59086 (Gene_ID) P04202/P17246 (A279-S390) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991) 10:1091-1101.|[2]M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14 (4) :2352-60.|[3]Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991. |[4]Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124 (Pt 14) :2501-10.|[5]Justin Rustenhoven, et al. TGF-beta1 regulates human brain pericyte inflammatory processes involved in neurovasculature function. Justin Rustenhoven. 2016 Feb 11;13:37.|[6]Kai Zhang, et al. Essential role of microglial transforming growth factor-β1 in antidepressant actions of (R) -ketamine and the novel antidepressant TGF-β1. Transl Psychiatry. 2020 Jan 27;10 (1) :32.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrofuran
TRC-N493840-50MG 50 mg

2-Nitrofuran

Sign In for Pricing
View Details
AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI10E1]
CF810234 100 µg

AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI10E1]

Sign In for Pricing
View Details
TissueScan, Liver Cancer cDNA Array I
LVRT301 5 Panels

TissueScan, Liver Cancer cDNA Array I

Sign In for Pricing
View Details
6-Nitrochrysene
TRC-N520220-500MG 500 mg

6-Nitrochrysene

Sign In for Pricing
View Details
GPBP1 Human Gene Knockout Kit (CRISPR)
KN422826 1 Kit

GPBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP02630PU-N 100 µL

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details