Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-8/CXCL8, Human (72a.a)

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells[1][2][3]. IL-8/CXCL8 Protein, Human (72a.a) is produced in E.coil, and consists of 72 amino acids (S28-S99) .

Product Specifications

Product Name Alternative

IL-8/CXCL8 Protein, Human (72a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-8-cxcl8-protein-human-72a-a.html

Purity

95.0

Smiles

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Molecular Formula

3576 (Gene_ID) P10145 (S28-S99) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Baggiolini M, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[2]Koch AE, et al. Interleukin-8 as a macrophage-derived mediator of angiogenesis. Science. 1992 Dec 11;258 (5089) :1798-801.|[3]M Baggiolini, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[4]M Wolf, et al. Granulocyte chemotactic protein 2 acts via both IL-8 receptors, CXCR1 and CXCR2. Eur J Immunol. 1998 Jan;28 (1) :164-70.|[5]Qian Liu, et al. The CXCL8-CXCR1/2 pathways in cancer. Cytokine Growth Factor Rev. 2016 Oct;31:61-71.|[6]Jian-Feng Liu, et al. IL-8 Is Upregulated in the Tissue-Derived EVs of Odontogenic Keratocysts. Biomed Res Int. 2022 Jul 30;2022:9453270.|[7]Remo C Russo, et al. The CXCL8/IL-8 chemokine family and its receptors in inflammatory diseases. Expert Rev Clin Immunol. 2014 May;10 (5) :593-619.|[8]Hai Jiang, et al. CXCL8 promotes the invasion of human osteosarcoma cells by regulation of PI3K/Akt signaling pathway. APMIS. 2017 Sep;125 (9) :773-780.|[9]L Laterveer, et al. Rapid mobilization of hematopoietic progenitor cells in rhesus monkeys by a single intravenous injection of interleukin-8. Blood. 1996 Jan 15;87 (2) :781-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW7-set siRNA/shRNA/RNAi Lentivector (Human)
20370091 4x 500 ng

FBXW7-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
RASGRF1 (S929) (Ras-specific Guanine Nucleotide-releasing Factor 1, Ras-GRF1, Guanine Nucleotide-releasing Protein, Ras-specific Nucleotide Exchange Factor CDC25, CDC25, GNRP, GRF1) (MaxLight 750)
MBS6479307-01 0.1 mL

RASGRF1 (S929) (Ras-specific Guanine Nucleotide-releasing Factor 1, Ras-GRF1, Guanine Nucleotide-releasing Protein, Ras-specific Nucleotide Exchange Factor CDC25, CDC25, GNRP, GRF1) (MaxLight 750)

Sign In for Pricing
View Details
RASGRF1 (S929) (Ras-specific Guanine Nucleotide-releasing Factor 1, Ras-GRF1, Guanine Nucleotide-releasing Protein, Ras-specific Nucleotide Exchange Factor CDC25, CDC25, GNRP, GRF1) (MaxLight 750)
MBS6479307-02 5x 0.1 mL

RASGRF1 (S929) (Ras-specific Guanine Nucleotide-releasing Factor 1, Ras-GRF1, Guanine Nucleotide-releasing Protein, Ras-specific Nucleotide Exchange Factor CDC25, CDC25, GNRP, GRF1) (MaxLight 750)

Sign In for Pricing
View Details
STAMBPL1 Peptide - N-terminal region
orb2012405 100 µg

STAMBPL1 Peptide - N-terminal region

Sign In for Pricing
View Details
2,5-Dichloro-p-xylene
GW3033-100g 100 g

2,5-Dichloro-p-xylene

Sign In for Pricing
View Details
2,3,6-Trifluorobenzoyl chloride
PC7285C-01 5 g

2,3,6-Trifluorobenzoyl chloride

Sign In for Pricing
View Details