Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His, solution)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-his.html

Purity

99.60

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Aldolase C (ALDOC) Human shRNA Plasmid Kit (Locus ID 230)
TR314832 1 Kit

Aldolase C (ALDOC) Human shRNA Plasmid Kit (Locus ID 230)

Ask
View Details
Mouse DNA Mismatch Repair Protein Mlh1 (MLH1) ELISA Kit
abx533184 96 Tests

Mouse DNA Mismatch Repair Protein Mlh1 (MLH1) ELISA Kit

Ask
View Details
RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (MaxLight 650)
MBS6224241-01 0.1 mL

RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (MaxLight 650)

Ask
View Details
RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (MaxLight 650)
MBS6224241-02 5x 0.1 mL

RBM15 (RNA-binding Motif Protein 15, Putative RNA-binding Protein 15, One-twenty Two Protein 1, OTT1, OTT, SPEN) (MaxLight 650)

Ask
View Details