Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His, solution)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-his.html

Purity

99.60

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)
MBS6449888-01 0.1 mL

TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)

Sign In for Pricing
View Details
TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)
MBS6449888-02 5x 0.1 mL

TIMP4 (TIMP-4, Tissue Inhibitor of Metalloproteinases 4) (MaxLight 650)

Sign In for Pricing
View Details
Zalifrelimab ELISA Kit
KET-10705 96 Tests

Zalifrelimab ELISA Kit

Sign In for Pricing
View Details
CWC22 (NM_020943) Human Tagged Lenti ORF Clone
RC210890L4 10 µg

CWC22 (NM_020943) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Guinea pig CRN (Corin) ELISA Kit
MBS2509901-01 24 Tests

Guinea pig CRN (Corin) ELISA Kit

Sign In for Pricing
View Details
Guinea pig CRN (Corin) ELISA Kit
MBS2509901-02 48 Tests

Guinea pig CRN (Corin) ELISA Kit

Sign In for Pricing
View Details