Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His, solution)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-his.html

Purity

99.60

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRF-1 Polyclonal Antibody
MBS8523038-01 0.1 mg

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details
GRF-1 Polyclonal Antibody
MBS8523038-02 0.1 mL (AF635)

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details
GRF-1 Polyclonal Antibody
MBS8523038-03 0.1 mL (AF610)

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details
GRF-1 Polyclonal Antibody
MBS8523038-04 0.1 mL (AF405S)

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details
GRF-1 Polyclonal Antibody
MBS8523038-05 0.1 mL (AF405L)

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details
GRF-1 Polyclonal Antibody
MBS8523038-06 0.1 mL (AF546)

GRF-1 Polyclonal Antibody

Sign In for Pricing
View Details