Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His, solution)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-his.html

Purity

99.60

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carabin Antibody
4267-01mg 0.1 mg

Carabin Antibody

Sign In for Pricing
View Details
PCDH17 Blocking Peptide
33R-8394 100 ug

PCDH17 Blocking Peptide

Sign In for Pricing
View Details
Human Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit
DL-RANTES-Hu-01 48 Tests

Human Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit

Sign In for Pricing
View Details
Human Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit
DL-RANTES-Hu-02 96 Tests

Human Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit

Sign In for Pricing
View Details
Rat IL-13 ELISA kit (4X96T)
LF-EK50658 4×96T

Rat IL-13 ELISA kit (4X96T)

Sign In for Pricing
View Details
BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)
MBS6277418-01 0.2 mL

BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)

Sign In for Pricing
View Details